PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G402700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 833aa    MW: 94244.3 Da    PI: 7.4635
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G402700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.66.1e-08387431246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++W+  Ed+ l+  v+  G  +W  Ia t+g++Rt+ qc  r+q 
  Aqcoe3G402700.1.p 387 NSWSNTEDKELISIVQNSGIYNWIEIATTLGTNRTPFQCLARYQR 431
                        58*****************************************96 PP

2Myb_DNA-binding41.72.6e-13439485148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        ++ WT+e+d +l +av+  G ++W  +a+++  +Rt+ qc +rw k l
  Aqcoe3G402700.1.p 439 KQEWTAEDDAQLCEAVEACGENDWQQVASKLE-RRTGVQCSNRWMKTL 485
                        789*****************************.***********9975 PP

3Myb_DNA-binding40.75.5e-13493538248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        grWT eEd  l+ av ++ ++ W++Ia+ +  gRt  qc++rw ++l
  Aqcoe3G402700.1.p 493 GRWTVEEDRHLKVAVMLFKPKMWHKIAQFVS-GRTQVQCRERWVNVL 538
                        8******************************.***********9975 PP

4Myb_DNA-binding43.57.4e-14545586245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        + WT+eEd +l+ a+ ++G   W+++a+ +   Rt++qc+ rw 
  Aqcoe3G402700.1.p 545 QEWTEEEDTKLKAAIVEHGHC-WSKVAASVA-PRTDNQCRRRWK 586
                        57*****************99.*********.9**********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.552281380IPR017877Myb-like domain
SMARTSM007170.0066285382IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-7288304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-7353391IPR009057Homeodomain-like
SuperFamilySSF466892.79E-14363430IPR009057Homeodomain-like
PROSITE profilePS500909.036381433IPR017877Myb-like domain
SMARTSM007173.8E-4385435IPR001005SANT/Myb domain
PfamPF002497.2E-6387431IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-14392442IPR009057Homeodomain-like
SuperFamilySSF466895.74E-19419488IPR009057Homeodomain-like
PROSITE profilePS5129419.607434489IPR017930Myb domain
SMARTSM007176.3E-14438487IPR001005SANT/Myb domain
PfamPF002492.4E-11439484IPR001005SANT/Myb domain
CDDcd001677.36E-11441485No hitNo description
Gene3DG3DSA:1.10.10.605.2E-16443488IPR009057Homeodomain-like
PROSITE profilePS5129410.134491538IPR017930Myb domain
SuperFamilySSF466892.11E-24491585IPR009057Homeodomain-like
SMARTSM007176.3E-11491540IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-17493542IPR009057Homeodomain-like
PfamPF002491.1E-11493538IPR001005SANT/Myb domain
CDDcd001672.93E-9494538No hitNo description
PROSITE profilePS5129422.3539593IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.4E-18543589IPR009057Homeodomain-like
SMARTSM007176.1E-13543591IPR001005SANT/Myb domain
PfamPF002492.0E-12545586IPR001005SANT/Myb domain
CDDcd001678.57E-12546589No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 833 aa     Download sequence    Send to blast
NFPSLNLTLP LDLKNISSRP DDCEVKEEVL VDEEMEAVQL GSDKLTEANP NQIKHSTTTC  60
ITTSTCSLVM SSRGSDVDEE DDDSETLGAI EKRFSIYGSD CPIENLESLL SKPELVHTTS  120
TDLESEATNI LSITKPSPQA LDKALTDPQQ ARSYSQTSES RFSLVSSGFL NHNTVYTFFH  180
AIKKNRSIQT CIRNKMIEIK VMLKEIKEHL RILKKFNFLC KTKTERAAYV KKDVNALLVS  240
VRKSTDSQNS KVNDKKLPAL FNGPVENPHV ANYRMVLMKF PVSLHRNKWS EKDKENLRRG  300
IEQQFQEMLF QKSVEVYSGA DECSGDSNTF DNVVTSISDI EITPEKIRSF LPKVDWQRLA  360
SMYASGRSGA ECETRWVNNE DPLINHNSWS NTEDKELISI VQNSGIYNWI EIATTLGTNR  420
TPFQCLARYQ RSLNCHIMKQ EWTAEDDAQL CEAVEACGEN DWQQVASKLE RRTGVQCSNR  480
WMKTLNPARE RVGRWTVEED RHLKVAVMLF KPKMWHKIAQ FVSGRTQVQC RERWVNVLDP  540
SLNLQEWTEE EDTKLKAAIV EHGHCWSKVA ASVAPRTDNQ CRRRWKILLP HEVPLLQAAR  600
RIEKSSLISN FVDREEERPG LSSSDFLPLP GIDAPEAENG TSSKEKNTKS STTTYKAICE  660
KSPTEAPLSK EASMMIHDDI VEPFGGDDSV SKNKKTHKLQ LKRKRCSEPA HVLNQELPRS  720
LQPSSDGTSS KKKTQPRTPG DGTKGLQDDS VLADSSRTDV LLTKRRKVPK PPSKRNKSTA  780
SAKHQEPLSP ELPTISRMTA LEPTINNSDR SYFTQKEEAC SPRQLDDCFK FS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-293555853155MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-293555853155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243797.10.0PREDICTED: uncharacterized protein LOC104587774 isoform X1
TrEMBLA0A059CZT70.0A0A059CZT7_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-163myb domain protein 4r1